|
||
ARTICLE |
Correspondence to Chris Lingle: clingle{at}morpheus.wustl.edu
|
|
|---|
subunits and regulate BK channel function. In humans, the KCNMB3 gene contains four N-terminal alternative exons that produce four functionally distinct β3 subunits, β3a–d. Three variants, β3a–c, exhibit kinetically distinct inactivation behaviors. Since investigation of the physiological roles of BK auxiliary subunits will depend on studies in rodents, here we have determined the identity and functional properties of mouse β3 variants. Whereas β1, β2, and β4 subunits exhibit 83.2%, 95.3%, and 93.8% identity between mouse and human, the mouse β3 subunit, excluding N-terminal splice variants, shares only 62.8% amino acid identity with its human counterpart. Based on an examination of the mouse genome and screening of mouse cDNA libraries, here we have identified only two N-terminal candidates, β3a and β3b, of the four found in humans. Both human and mouse β3a subunits produce a characteristic use-dependent inactivation. Surprisingly, whereas the hβ3b exhibits rapid inactivation, the putative mβ3b does not inactivate. Furthermore, unlike hβ3, the mβ3 subunit, irrespective of the N terminus, mediates a shift in gating to more negative potentials at a given Ca2+ concentration. The shift in gating gradually is lost following patch excision, suggesting that the gating shift involves some regulatory process dependent on the cytosolic milieu. Examination of additional genomes to assess conservation among splice variants suggests that the putative mβ3b N terminus may not be a true orthologue of the hβ3b N terminus and that both β3c and β3d appear likely to be primate-specific N-terminal variants. These results have three key implications: first, functional properties of homologous β3 subunits may differ among mammalian species; second, the specific physiological roles of homologous β3 subunits may differ among mammalian species; and, third, some β3 variants may be primate-specific ion channel subunits.
© 2008 Zeng et al. This article is distributed under the terms of an Attribution–Noncommercial–Share Alike–No Mirror Sites license for the first six months after the publication date (see http://www.jgp.org/misc/terms.shtml). After six months it is available under a Creative Commons License (Attribution–Noncommercial–Share Alike 3.0 Unported license, as described at http://creativecommons.org/licenses/by-nc-sa/3.0/).
The Rockefeller University Press
| INTRODUCTION |
|---|
|
|
|---|
subunits encoded by the single Slo1 gene (KCNMA1) (Butler et al., 1993
In humans, there are four β3 splice variants that arise from four alternative exons each encoding a distinct N terminus (Uebele et al., 2000
). Three of these are capable of mediating N-terminal–mediated inactivation of distinct temporal characteristics (Uebele et al., 2000
; Xia et al., 2000
; Zeng et al., 2007
). Effects of the human β3 subunits on gating shifts appear to be minimal, except as a consequence of inactivation (Xia et al., 2000
). Two of the β3 inactivating isoforms, β3a, and β3b, have been studied in some detail (Xia et al., 2000
; Lingle et al., 2001
; Zeng et al., 2007
) and exhibit distinctive inactivation behaviors that presumably depend on the specific N-terminal sequences. Given that further exploration of the physiological roles of inactivating BK auxiliary subunits will certainly depend on investigations in mice or rats, here we have undertaken an examination of the identity and function of mouse BK β3 subunits. The results indicate that, in contrast to the four variants found in the human genome, the mouse genome encodes a single N-terminus, β3a, that is a clear homologue of a human variant. A second mouse variant similar to human β3b was also identified, but this appears to be of independent origin with distinct functional properties. We also undertook a comparison of conservation among β3 genes over a wide range of vertebrate species. This analysis suggests that β3b, β3c, and β3d may represent primate-specific genes. The analysis raises the possibility that β3 variants may have unique functions in primates and points out that the physiological roles of even homologous subunits may differ among species.
| MATERIALS AND METHODS |
|---|
|
|
|---|
and β3 cRNA was typically prepared at
1 µg/µl, with Slo1
cRNA diluted
1:40 before injection. The final standard ratio by mass of
:β3 RNA was
1:2.
Cloning and Generation of β3 Subunits
The preparation of human β3 subunits has been previously described (Xia et al., 2000
). Mouse liver and testes cDNA libraries (Strategene) were used to screen for mβ3 variants using nested PCR. The first round PCR was performed with a LacZ reverse primer (5'GGAAACAGCTATGACCATG) and mβ3 primer (5'GAGCATGAAGGGCTTCAACACAGT). After a second round PCR with T3 primer and another mβ3 primer (5'CATCATGGCCACGCCCAGCAGCATGGC), the PCR products were analyzed with EcoRI and HINDIII and then subcloned into the pSK vector. 40 clones were analyzed and clone 39 corresponded to a β3b N terminus, with upstream residues corresponding to an open reading frame present within the mouse genome. This clone encoded a single methonione appended to exon 2 (primer sequence: lower case; putative exon 1b: underlined; exon 2: upper case; gaattcggcacgaggGCAACTGCCACTCTGCAACGGCTTCCCACAACCCAGGGTTTCATGGATGCTTGGCAAACACTTTCCCAACAGAGGCTACCTCTCCAGTACCAGTATTCTACTTTAAAAAAAGATTTATTTTATGACAGCACTTCCGGCCTCGGGCAAAATCAATGGAGATCCCCTGAAGGTGCACCCAAAGCTT). The putative 1b transcript corresponds to position chr3:32,400,082-32,400,204 in the July, 2007 assembly of the mouse genome. In addition to this putative β3b N terminus, five other clones were obtained that contained putative reading frames appended to the shared β3 exon 2. Three (termed w, y, and z) of these did not encode an initiation methonine in the putative reading frame. Two others arose from different reading frames of the same region. One (putative Exon x1), corresponding to an open reading frame located 1,696 bp upstream of exon 1b, would result in an additional 42 N-terminal residues (MPVGRSKGVTSPRSFSATKSVGVNLVYVGPRIDREREWPDYV). Only nucleotide sequence corresponding to the underlined translated residues was identified from cloning. The second (putative Exon x2) would result in addition of a single N-terminal methonine to exon 2, but with an alteration in the first residue following M such that the N terminus would begin MSLP instead of MTALP. No homologues corresponding to these sequences were found in a blast search of the human genome database and no rodent ESTs containing such N termini are present in current databases. A region of the rat genome shared homology with the putative exons x1 and x2, including a conserved GTGAGT intron–exon splice junction, but in the rat genome, the reading frame corresponding to exon x1 fails to encode an initiation methionine.
Mouse β3 subunits were generated by first cloning most of the β3 subunit (exons 2, 3, and 4) via PCR from the mouse liver cDNA library. Subsequently, β3a and β3b variants were generated by overlapping PCR from the 1a- and 1b-specific exons. Mutations of β3a and β3b subunits followed standard procedures in use in the laboratory (Xia et al., 2003
; Zeng et al., 2003
).
Electrophysiology
Currents were typically recorded in the inside-out configuration (Hamill et al., 1981
) with an Axopatch 200 amplifier (Molecular Devices). For experiments with charybdotoxin, outside-out patches were employed. Voltage commands and data acquisition was accomplished with the Clampex program from the pClamp software package (Molecular Devices). The standard pipette/extracellular solution contained (in mM) 140 K-methanesulfonate, 20 KOH, 10 HEPES, 2 MgCl2, pH 7.0. Gigaohm seals were formed while oocytes were bathed in frog Ringer (in mM, 115 NaCl, 2.5 KCl, 1.8 CaCl2, 10 HEPES, pH 7.4). Patches were then excised into a flowing 0 Ca2+, high K+ solution. The composition of solutions bathing the cytoplasmic face of the patch membrane contained (in mM) 140 K-methanesulfonate (K-MES), 20 KOH, 10 HEPES. 5 mM EGTA was used for 0, 1, and 4 µM Ca2+ solutions, while 5 mM EGTA was used for 10 µM Ca2+ solutions. 60 and 300 µM Ca2+ solutions contained no added Ca2+ buffer. Solutions of defined Ca2+ were titrated to appropriate pCa with Ca-MES and calibrated against solutions of defined Ca2+ concentrations (World Precision Instruments) using a Ca2+-sensitive electrode.
Solutions at the cytosolic face of membranes were controlled by a local application system containing six distinct perfusion lines. Each line was under independent solenoid control and solution flowed continuously from only one line at a time onto the excised patch. All experiments were at room temperature (
22–25°C). Salts and CTX were obtained from Sigma-Aldrich.
Data Analysis
Analysis of current recordings was accomplished either with Clampfit (Molecular Devices) or with programs written in this laboratory. For families of G/V curves obtained within a patch, conductances were normalized to estimates of maximal conductance obtained at a Ca2+ concentration where a clear maximum was obtained. Individual G/V curves were fit with a Boltzmann function of the following form:
![]() | (1) |
Genome Searches
For many of the genomes examined, gene assembly remains incomplete and annotation of the KCNMB genes is not available. Our examination of conservation within the KCNMB3 gene occurred in two passes. First, we used default BLAST settings using tblastn to search for known β subunit sequences. Second, we used the capabilities of the University of California-Santa Cruz Genome Bioinformatics website (www.genome.ucsc.edu; Kent et al., 2002
) to obtain measures of conservation among various species within the presuming coding regions of the KCNBM3 N-terminal splice variants.
Tblastn searches typically returned regions of strong identity that reflect likely exons. Such exons were then assembled into the putative full subunit based on alignments with the validated β subunits. Sequence information for some genomes remains incomplete and, in some cases where genomes have only been sequenced at low coverage, sequencing errors may persist in the available databases. Tblastn searches were conducted on a number of genomes accessible from the www.ncbi.nlm.nih.gov/blast web page (chimp, rhesus monkey, cow, horse, cat, dog, mouse, rat, possum, platypus), additional genomes accessible from Ensembl www.ensembl.org) release 47 web page (squirrel, bushbaby, tree shrew) and also the marmoset genome-sequencing project webserver (http://genome.wustl.edu/genome.cgi?GENOME=Callithrix%20jacchus). Mammalian genomes considered include human (Homo sapiens), chimpanzee (Pan troglodytes), rhesus monkey (Mulatta macaca), marmoset (Callithrix jacchus), bushbaby (Otolemur garnetti), tree shrew (Tupaia belangeri), thirteen-lined ground squirrel (Spermophilus tridecemlineatus), cow (Bos taurus), horse (Equus caballus), mouse (Mus musculus), rat (Rattus norvegicus), cat (Felis catus), dog (Canis lupis familiaris), opossum (Monodelphis domestica), and duck-billed platypus (Ornithorhynchus anatinus).
For the comparison of conservation using the UCSC genome browser (Kent et al., 2002
), segments of putative human or rodent KCNMB3 exons were used to extract potentially homologous segments from other species. For searches for homologues of exon 1b sequences, the BLAT search was used (Kent, 2002
). Aligned segments were examined visually for evidence of a GT base sequence at the donor splice site. PhastCons estimates of conservation (Siepel et al., 2005
) were made both on a 28 species set of vertebrates and an 18 species set of placental mammals (human, chimp, rhesus, bushbaby, treeshrew, mouse, rat, guinea pig, rabbit, shrew, hedgehog, dog, cat, horse, cow, armadillo, elephant, tenrec); the placental mammal scores were used for display purposes. PhastCons scores are calculated based on a probabilistic model (two-state phylogenetic hidden Markov model) that considers the likelihood of DNA substitution at any position and the way this changes from one position to another (Siepel et al., 2005
). Scores reflect evolutionary distances among species, a model of the nucleotide substitution process, and a tendency for correlations in conservation levels to be found among adjacent sites in a genome.
For species in which specific annotation is available, GenBank/EMBL/DDBJ nos. are as follows: human, NM_171828; chimp, XM_001167560 (predicted); mouse, XM_912348 (predicted); rat, AB297662(EST).
Online Supplemental Material
The paper refers to eight supplemental figures (available at http://www.jgp.org/cgi/content/full/jgp.200809969/DC1) that provide additional information about β subunit sequence alignments (β3, Fig. S1; β1, Fig. S2; β2, Fig. S3; β4, Fig. S4), information about exon maps for various species (Fig. S5), translations in multiple reading frames for multiple species of the segments adjacent to exon 2 (Fig. S6), and homologies in N-terminal inactivation domains for Kv β (Fig. S7) and
(Fig. S8) subunits.
| RESULTS |
|---|
|
|
|---|
Identification of Potential Mouse β3 N-terminal Splice Variants from Database Searches and Cloning
The mouse genome was searched for sequences that exhibit homology to the four human β3 N-terminal splice variants. Sequence corresponding to a β3a N terminus (exon 1a; see Fig. 1 D for gene map) was readily identified (Fig. 1 A).
Furthermore, a rat β3a EST (AB297662) was found in the public database supporting the view that this is an expressed sequence. Examination of multiple genomes revealed that the β3a N terminus is highly conserved in mammalian genomes (also see Fig. 2). The β3a N terminus is, in fact, one of the more highly conserved parts of the entire β3 subunit.
|
Finally, using a tblastn search of genomic and EST databases, no homologues of β3c or β3d were identified in either mouse or rat genomes, although some weak homologues were identified in other genomes (Fig. 1, B and C). All such homologues mapped to appropriate positions within the KCNMB3 genes (see Fig. S5). In sum, these considerations establish that a candidate β3b message is generated in mouse and that an exon encoding a β3a N terminus is present in the mouse genome. KCNMB3 1c and 1d exons are clearly not present in either mouse or rat genomes for which sequencing is thought to be largely complete.
The potential significance of the differences in the presence or absence of β3b, β3c, and β3d variants among species will be considered in more detail below. Furthermore, we present a comparison of the functional differences between the two candidate mouse KCNMB3 N-terminal exons, 1a and 1b, and their human counterparts.
The β3 1a Exon Is Highly Conserved among Mammals
Fig. 1 A showed that the 1a exon appears to be highly conserved among mammals, thereby suggesting that this gene region may provide a potential quantitative benchmark for expected strong conservation. The 1a exon region of the KCNMB3a gene was therefore analyzed with the conservation analysis features of the UCSC genome browser (Kent et al., 2002
; Siepel et al., 2005
). Fig. 2 illustrates nucleotide alignments along with PhastCons scores for a set of 17 placental mammals along with human (see Materials and methods).
The complementary nucleotide sequences are displayed and presented in an order reversed from that used for amino acid alignments. The 1a exon exhibits strong conservation (PhastCons scores > 0.5) over most of its length and also contains a highly conserved canonical 5' GT intron–exon splice donor site. These considerations support the view that there is strong selective pressure that has maintained the KCNMB3 1a exon within mammals.
|
with mβ3a subunits resulted in inactivating currents (Fig. 3).
mβ3a subunits (Fig. 3 A) cause somewhat faster and more complete inactivation than hβ3a (Fig. 3, B and C). Whereas for hβ3a, persistent noninactivating current at +100 mV was 5.6 ± 0.6% (n = 3) of the maximal peak hβ3a current (measured after removal of inactivation by trypsin), for mβ3a the persistent current was 2.1 ± 0.3% (n = 6) of the maximum current. On average, mβ3a subunit results in about threefold faster inactivation than the human subunit (Fig. 3 C). Both subunits produce a characteristic inactivation-dependent slow tail current that is removed by digestion of the N terminus with trypsin (Fig. 3 D). The slow, use-dependent tail current appears to be the key functional property defined by the highly conserved β3a exon.
|
1b-Type Exons May Have Arisen Independently in Primates and Rodents, and May Be Absent in Other Species
Although we were able to clone a mouse 1b homologue, several factors raise some uncertainty as to whether the 1b homologue reflects a valid subunit variant. First, the position of the cloned candidate mouse 1b exon relative to the 1a exon was reversed in comparison to humans, suggesting that the putative mouse 1b exon may be of independent origin (Fig. 1 D). Second, because cloning revealed additional N-terminal sequences of unknown origin (see Materials and methods), some caution is warranted regarding the origins of the candidate 1b clone. Third, the upstream noncoding sequence of the candidate 1b mouse segment exhibits minimal homology to that in humans. To further compare the putative 1b exons in both human and mouse, here we have examined the extent of conservation in nucleotides near human and mouse candidate 1b exons. If 1b exons contribute to expressed proteins that are conserved among sets of species, selective pressures should be acting upon the β3b subunits. In such cases, one might expect that there would be some conservation among genomes both in the intron–exon junction preceding the 1b exon and in its noncoding region.
A 200-bp segment of nucleotides corresponding to the noncoding sequence upstream of the human 1b ORF was compared against other genomes (Fig. 4 A), revealing a similar segment in both chimp and rhesus monkey. Other mammalian genomes did not reveal any homologous segment. All three primate genomes shared an appropriate canonical 5' GT intron–exon splice donor site (GTAAGT; reverse complement). In contrast, when the 123 base pairs identified in the cloned candidate mouse 1b sequence were compared (using the mm9 mouse genome build) against genomes of other placental mammals, no homologues were identified (Fig. 4 B), although the candidate mouse 1b exon was preceded by an appropriate intron–exon 5' splice donor site.
|
|
Unlike hβ3b, the Putative mβ3b' Subunit Does Not Cause Inactivation of BK Current
The hβ3b subunit produces BK currents that exhibit rapid, but incomplete inactivation (Xia et al., 2000
; Lingle et al., 2001
). In contrast, coexpression of the putative mβ3b' subunit with mSlo1
subunits resulted in currents that did not show time-dependent inactivation (Fig. 6 A).
To test for the possibility that a very rapid inactivation process may be masking any visible time-dependent inactivation, trypsin was applied to the cytosolic face of such patches. No increase in outward current amplitude was observed (Fig. 6 B). These effects contrast markedly to the behavior of the human β3b subunit (Fig. 6, C and D).
|
Two alterations were made in hβ3b in an attempt to make it more like mβ3b'. Construct hβ3b-F4L produced no observable time-dependent inactivation (Fig. 7 B) using protocols that reveal fast inactivation with wild-type hβ3b (see Fig. 7 A).
However, application of trypsin resulted in pronounced increases in the outward current activated at positive potentials, indicative that the MTAL N terminus was still able to produce some block of the channel. However, the trypsin-mediated increase in current was much less than is observed for wild-type hβ3b (Fig. 7 A), indicative that the F4L mutation does weaken block by the β3 N terminus. In a second construct, hβ3b-
10-15, a deletion of six residues resulted in currents that showed a slight hint of time-dependent inactivation, but only at the most positive activation potentials (Fig. 7 C). However, the currents exhibited substantial voltage-dependent block of steady-state current at positive potentials, indicative that the N terminus is still capable of blocking the channel. Application of trypsin for durations that readily remove hβ3b inactivation had only minor effects on the outward current block of hβ3b-
10-15. We interpret these results to indicate that the
10-15 deletion reduces the blocking affinity of the β3b N terminus. The failure of trypsin to remove this block probably relates to the shortening of the N terminus and the fact that β subunit N termini can be to some extent protected from digestion by trypsin when positioned within the antechamber formed between the pore domain and the cytosolic domain (Zhang et al., 2006
). The resistance of hβ3b-
10-15 to digestion by trypsin is somewhat surprising, given that in the
10-15 construct, a lysine at position 9 might be expected to be subject to digestion by trypsin. However, there may be secondary structural aspects of the β3b N terminus that also contribute to the failure of trypsin to digest this construct. We also examined an mβ3b' subunit with an L4F mutation. In this case, currents did not reveal any rapid time-dependent inactivation, but trypsin application produced a slight increase in outward current. Overall, these results are consistent with the idea that phenylalalanine in position 4 may help stabilize the inactivated state, and that the length of the N terminus is also important in permitting inactivation to occur. However, the fact that neither the chain length nor the F/L mutation completely converts human to mβ3b behavior suggests that other differences in the N terminus are also likely to contribute to the inability of the mβ3b subunit to produce inactivation.
|
+mβ3b' subunits were clearly activated at voltages negative to 0 mV (Fig. 6 B2) in contrast to currents resulting from
+hβ3b (Fig. 6 D2).
To define the properties of
+ mβ3b' currents, GV curves were measured at various Ca2+. Because of a slow rightward shift in GV curves following excision of patches containing
+mβ3b subunits, patches were only used if GV curves obtained with 10 µM Ca2+ both at the beginning and end of the test series shifted <10 mV. Typically, GV curves for these experiments were determined within the first 10 min of patch excision. Tested concentrations were limited to 0, 1, 10, and 300 µM Ca2+. Representative GV curves are shown in Fig. 8 A and the Vh as a function of Ca2+ (Fig. 8 B) shows that at any Ca2+ the Vh for activation is shifted negatively
50–70 mV relative to Slo1 alone.
Similar shifts in GV curves were not observed with human β3 subunits. Activation and deactivation time constants for
+mβ3b' currents were also determined over a range of Ca2+ concentrations (Fig. 8 C). In comparison to Slo1
alone, mβ3b' results in a substantial slowing of deactivation, similar to previously described effects of β1 and β2 subunits (Wallner et al., 1999
; Xia et al., 1999
; Cox and Aldrich, 2000
). However, whereas both β1 and β2 also slow activation, a phenomenon particularly noticeable at 0 Ca2+, the mouse β3b' subunit has only small effects on current activation at 0 Ca2+ at potentials positive to +100 mV. In sum, the ability of the mouse β3 subunit to shift gating differs markedly from the behavior of the human β3 subunit (Zeng et al., 2001
). Single channel patches were used to define the open probability (Po) at 0 Ca2+ over a range of voltages for
+mβ3b' and at +200 mV for
alone (Fig. 8 E). Consistent with the macroscopic currents, the mβ3b' subunits shifts gating at 0 Ca2+ relative to channels arising from
subunits alone.
|
+hβ3 subunits exhibit a marked curvature with larger conductances at more positive potentials. Furthermore, single
+hβ3 channel openings exhibit the characteristics of a rapid voltage-dependent block at more negative potentials that is relieved with depolarization. These properties have been shown to arise from the hβ3 extracellular loop (Zeng et al., 2003
+mβ3' currents (Fig. 9 A) and compared them to similar I-V curves obtained from currents arising from subunits alone and for currents from
+hβ3 subunits (Fig. 9 B).
+mβ3b' instantaneous I-V curves exhibited substantially less outward rectification than the
+hβ3b currents, although more than
subunits alone. To confirm that the instantaneous I-V curves reflected the conductance properties of the underlying single channels, openings of single
+mβ3b' were examined over a similar range of voltages (Fig. 9 C). The curvature in the single channel IVs were found to mirror the behavior of the macroscopic instantaneous I-V curves. In sum, the mouse β3 subunit exhibits less macroscopic outward current rectification than its human counterpart, and the single channel openings exhibit less reduction in conductance at negative potentials. For mouse
+β3b' channels, the single channel slope conductance measured over the range of 0 to +140 mV was 207.7 ± 4.1 pS (n = 9). We postulate that the somewhat shorter length of the mβ3 extracellular loop may contribute to the differences in rectification behavior between the two homologues.
|
80 nM, which contrasts to an IC50 of
2–4 nM for
subunits alone measured under similar conditions (Xia et al., 1999
+mβ3'. Similar to results with hβ3, the estimated IC50 for block at +120 mV was 104.7 ± 14.2 nM (n = 6).
β3c and β3d Exons May Be Unique to Primates
As noted above, β3c and β3d exons were not readily revealed in blast searches of available genomes. Some of these genomes, such as mouse and rat, are at sufficient coverage that it would be unlikely that homologous exons would be overlooked and clearly the searches did reveal weak candidate homologues in some genomes (Fig. 1, B and C). However, to better address this issue, we undertook an examination of conservation among genomes over the region containing the potential exons 1c and 1d.
The 1d and 1c exons in humans immediately precede exon 2, with the 1c reading frame being contiguous with exon 2. Fig. 10 A displays nucleotide alignments spanning the end of exon 2 through the identified coding sequence of the human 1c exon. A PhastCons evaluation within the placental mammals indicates only weak conservation over exon 1c, suggesting that there has been little selective pressure to maintain sequence in this region. In some species, gaps and inserts disrupt the alignments and, furthermore, except for the primates, only in horse and cat is a putative AUG (complement: CAT) methionine-encoding triplet observed in the reading frame (see Fig. S6 for translations of the nucleotide sequences for all reading frames). Although it is not possible to exclude the possibility that within the lower mammals some of these reading frames encode expressed 1c exons, the overall absence of conservation among mammals suggests that the primate-specific 1c exon is likely to be functionally unique.
|
Whereas the β3c subunit variant containing the 1c exon produces inactivating currents that differ in kinetic and steady-state behavior from inactivation produced by either β3a or β3b subunits (Uebele et al., 2000
; Xia et al., 2000
; Zeng et al., 2007
), the functional properties conferred on BK channels by the β3d variant are less certain. Uebele et al. (2000)
noted that they were unable to obtain any evidence that the β3d variant was expressed in heterologous systems, while expression in native cells is only supported by the presence of the β3d variant in cDNA. Similarly, in studies of
+ β3d subunits in oocytes, we have found that the resulting currents are indistinguishable from those resulting from
alone. Furthermore, the currents do not have the characteristic rectification of the macroscopic instantaneous current–voltage relationship (e.g., see Fig. 9) that is diagnostic for expression of human β3 subunits. As such, the role of β3d subunits in BK channel function remains uncertain, but its existence in native tissues is strongly supported by the presence of β3 message both in human cDNA libraries and in Northern blots of various human tissues (Uebele et al., 2000
).
N Termini of Inactivating Kv Subunits Exhibit Little Divergence among Mammals
Given the substantial sequence variability in β3 N termini among species, we wondered whether N-terminal variability might be common in other segments thought to be important in mediating rapid inactivation. We therefore compared the first 40 N-terminal residues of N termini of inactivating Kv
and β subunits among the same set of species. These comparisons show strong conservation among mammalian species particularly in the initial 10–20 residues likely to be critically important in terms of defining inactivation behavior. It has been shown for both Kv (Hoshi et al., 1990
; Murrell-Lagnado and Aldrich, 1993
) and BK β2 (Xia et al., 2003
) N termini that the basic ability of an N terminus to produce inactivation can tolerate a variety of manipulations of the N terminus, albeit with some alteration of the inactivation kinetics. However, the strong selection for a particular N-terminal sequence across species suggests that the kinetic properties conferred by a given N terminus likely have very strongly defined functional consequences. These considerations further emphasize the unique nature of the species-specific changes in the β3 N termini.
| DISCUSSION |
|---|
|
|
|---|
Physiological Roles of β3 Subunit Variants Will Differ among Species
Among the family of subunits encoded by the four KCNMB genes, the β3 subunit shows substantially more amino acid variation than other BK β subunits and, remarkably, this also includes variation in the number and properties of alternative exons that encode the functionally critical N terminus. Of the four distinct N-terminal splice variants identified in human (Uebele et al., 2000
), we have identified only two variants in mouse (and rat), exons 1a and 1b', which might be considered similar to those in humans. However, despite the similarity in amino acid sequences encoded by these exons, our functional analyses suggest that the rodent β3 N-terminal variants are likely to have distinct functional consequences than their human counterparts.
The mouse (and rat) appear to share with humans only one true orthologue, β3a. Both human and rodent β3a subunits result in qualitatively similar behavior, an interesting inactivation-dependent development of a slow tail current (Zeng et al., 2007
). However, there are marked differences between the two in terms of the rate of onset of inactivation and also the extent of steady-state inactivation, which impact on the rate of development of the slow tail current. These differences may be in part linked to differences between the human and mouse β3 subunits in terms of their effects on the apparent Ca2+ dependence of gating, with the mouse β3a subunit shifting gating approximately –60 mV at a given [Ca2+] in comparison to the hβ3a subunit. Overall, we would therefore predict that BK channels containing either rodent or human β3a subunits would have quite different effects on cellular excitability. Yet, we think it is important to keep in mind that the strong conservation in mammals of the 20-residue β3a exon suggests that the slow, use-dependent tail current prolongation produced by this N terminus (Zeng et al., 2007
) likely plays some conserved physiological role in BK channel function, wherever it is expressed.
The mouse and rat genomes also appear to encode a second candidate β3 N-terminal variant, termed exon 1b', which, similar to the human 1b exon, encodes a single N-terminal methionine. However, since this 1b' exon most likely arose independently of the 1b exon in primates and the mβ3b' and hβ3b subunits results in distinct species-specific functional differences, it seems likely that the two variants do not represent true orthologues. The functional differences between mβ3b' and hβ3b are even more dramatic than for the β3a subunits, with hβ3b subunit producing a very rapid inactivation that, in effect, results in marked current rectification, while the mβ3b' subunit produces no observable inactivation.
Together these comparisons indicate that the physiological contributions of these apparently similar subunits will almost certainly differ markedly between primates and rodents. At present, no information is available about the expression pattern of β3 subunits in rodents to aid in assessing the potential physiological roles of such channels in native tissues. These observations point out that caution must be exercised in regards to cross species inferences regarding a physiological role of a particular subunit, when that subunit may differ substantially in sequence, function, and most likely loci of cellular expression.
Significance of β3 N-terminal Diversity among Species
The results presented here show that the KCNMB3 gene has undergone extensive evolutionary change in N-terminal variation. Although the comparisons undertaken here have used some genomes in which the current level of sequencing is incomplete and/or at low coverage, the regions of the genomes compared here, particularly with respect to the β3c and β3d variants, appear sufficiently complete that this concern is minor.
Perhaps most intriguingly, three of the four β3 N-terminal variants found in humans may be primate-specific gene products. This includes β3b, β3c, and β3d. The reasons for considering the human β3b subunit distinct from the rodent β3b' were considered above. We cannot exclude that other similar β3b paralogues may have arisen in other mammalian genomes and would not have been recognized in our evaluations. However, for the present, the results indicate that no homologue of the primate 1b exon can be found in other genomes. The apparent absence of homologues for the β3c and β3d N-terminal variants in both the mouse and rat genomes prompted our search of other genomes and also a close examination of the reading frames upstream of exon 2 in various species. PhastCons scores of placental mammals in the 1c and 1d coding regions revealed little conservation in nucleotides, indicative that there has been little selective pressure in the candidate coding regions. Furthermore, the presence of inserts and gaps, the absence of appropriate initiation methionines encoded in the open reading frames, and, in the case of the 1d exon, a lack of conservation at the GT intron–exon splice donor site argue strongly that these regions have undergone considerable change throughout the evolution of mammals and that there has been little selective pressure that might minimize any changes. As such, these considerations lead substantive support to the idea that both the 1c and 1d exons are primate-specific exons, leading to a diversity of KCNMb3 isoforms apparently not present in the non-primates. Even if 1c or 1d exons were expressed in some non-primates, the predicted sequence differences suggest that both β3c and β3d variants define ion channel subunits that are functionally specific to high primates.
What might the specific functional roles of the KCNMB3 variants be in primates? In regards to the first question, the only information of some relevance is the distribution of β3 message in Northern blots from human tissues (Uebele et al., 2000
). Interestingly, of the four N-terminal variants, the most evolutionarily conserved variant, β3a, shows the most restricted distribution, being found primarily in spleen and placenta, with weaker presence in heart, kidney, and pancreas. In contrast, message for β3b, β3c, and β3d exhibits widespread distribution, with each subunit showing particularly robust expression in particular loci (β3b: kidney, pancreas, spleen; β3c: liver, kidney, pancreas, spleen; β3d: kidney, pancreas, testes, spleen). Of the four human KCNMB3 variants, the β3a (Zeng et al., 2007
) and β3b (Xia et al., 2000
; Lingle et al., 2001
) are the most extensively studied, and properties of β3c and β3d have only been noted in passing. The β3c, like β3a and β3b, produces inactivation (Uebele et al., 2000
; Xia et al., 2000
), although it does not appear to share the use-dependent properties characteristic of β3a. The β3c variant has been shown by immunohistochemistry to be present in human pancreatic β cells (Uebele et al., 2000
), but properties of BK channels in such cells have not been defined. As noted in the Results, knowledge about β3d is even more limited, and its effects on BK channels studied in heterologous systems remains unclear. Potentially, BK currents can be investigated in cells from some of these tissues that contain β3b, β3c, or β3d message to test whether currents of appropriate properties can be found and what the physiological roles of such currents might be.
Another question raised by these results is, why is there such extensive N-terminal variation in the KCNMB3 gene? At present, there is insufficient information to answer this question and we may not even know the full extent of the N-terminal variation. For example, although the present work establishes two candidate KCNMB3 N-terminal exons in rodents, it may be the case that additional variants, perhaps the putative x1 and x2 exons described in the Materials and methods, may also occur. Similarly, the failure to identify by genomic analysis viable exons other than the 1a exon in many species does not preclude that additional N-terminal variants may be found in those species.
Summary
Ultimately, elucidation of the potential physiological roles of β3 subunits will be aided by studies in rodent species, a fact that motivated the characterization of β3 functional properties in mouse presented here. However, the marked functional differences observed here between human and mouse β3 subunit variants argue that any role defined by genetic manipulations in mice may not be strictly applicable to other species, including humans. On the other hand, since β3a seems to be the major KCNMB3 variant in mice, a general KO of the KCNMB3 gene is likely to lead to some understanding about the possible physiological roles of the slow use-dependent tail currents mediated by this subunit. Overall, the present results highlight an important lesson of comparative physiology, that proteins that are presumably homologous across species may have quite different functional properties and perhaps different physiological roles among different species.
| ACKNOWLEDGMENTS |
|---|
This work was supported by GM081748 to C. Lingle.
Lawrence G. Palmer served as editor.
Submitted: 22 January 2008
Accepted: 16 June 2008
| REFERENCES |
|---|
|
|
|---|
and auxiliary β subunits on functional properties of BK-type Ca2+-activated K+ channels. J. Neurosci. 22:1550–1561.This article has been cited by other articles:
![]() |
Z. Zhang, X.-H. Zeng, X.-M. Xia, and C. J. Lingle N-terminal Inactivation Domains of {beta} Subunits Are Protected from Trypsin Digestion by Binding within the Antechamber of BK Channels J. Gen. Physiol., March 1, 2009; 133(3): 263 - 282. [Abstract] [Full Text] [PDF] |
||||
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|