Table 2. Single-channel conductance in selected K+ channels
Accession no.GeneProteinPore helix-S6 sequencepSReference
Pore helixSelectivity filterPore-S6
Small conductance
NP_728123.1SHAKERShakerAFWWAVVTMTTVGYGDMTPVGVWGKIVGSLCAIAGVLTIALPV P VIVSNFNYFYHR48720Carvacho et al., 2008
NP_000208.2KCNA1Kv1.1AFWWAVVSMTTVGYGDMYPVTIGGKIVGSLCAIAGVLTIALPV P VIVSNFNYFYHR41710Gutman et al., 2005
NP_004965.1KCNA2Kv1.2AFWWAVVSMTTVGYGDMVPTTIGGKIVGSLCAIAGVLTIALPV P VIVSNFNYFYHR41914Carvacho et al., 2008
AAC31761.1KCNA3Kv1.3AFWWAVVTMTTVGYGDMHPVTIGGKIVGSLCAIAGVLTIALPV P VIVSNFNYFYHR73713Gutman et al., 2005
NP_002224.1KCNA4Kv1.4AFWWAVVTMTTVGYGDMKPITVGGKIVGSLCAIAGVLTIALPV P VIVSNFNYFYHR5695Gutman et al., 2005
AAA61276.1KCNA5Kv1.5AFWWAVVTMTTVGYGDMRPITVGGKIVGSLCAIAGVLTIALPV P VIVSNFNYFYHR52310Carvacho et al., 2008
NP_002226.1KCNA6Kv1.6AFWWAVVTMTTVGYGDMYPMTVGGKIVGSLCAIAGVLTIALPV P VIVSNFNYFYHR4679Gutman et al., 2005
AAX11186.1KCNA7Kv1.7SFWWAVVTMTTVGYGDMAPVTVGGKIVGSLCAIAGVLTISLPV P VIVSNFSYFYHR40321Carvacho et al., 2008
NP_005540.1KCA10Kv1.8GFWWAVVTMTTVGYGDMCPTTPGGKIVGTLCAIAGVLTIALPV P VIVSNFNYFYHR46612Gutman et al., 2005
NP_004761.2KCNB2Kv2.2SFWWATITMTTVGYGDIYPKTLLGKIVGGLCCIAGVLVIALPI P IIVNNFSEFYKE42615Carvacho et al., 2008
Large conductance
P0A334.1KCSAKcsAALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVT A ALATWFVGREQE120100Nimigean et al., 2003
Q9YDF8.1KVAPKvAPALWWAVVTATTVGYGDVVPATPIGKVIGIAVMLTGISALTLLI G TVSNMFQKILVG253170Ruta et al., 2003
O27564.1MTHKMthKSLYWTFVTIATVGYGDYSPSTPLGMYFTVTLIVLGIGTFAVAV E RLLEFLINREQM104200Shi et al., 2011
NP_001240307.1KCMA1MSlo1CVYLLMVTMSTVGYGDVYAKTTLGRLFMVFFILGGLAMFASYV P EIIELIGNRKKY332270Brelidze et al., 2003

Multiple alignment of the primary structure of K+ channel pores. The signature sequence TVGYGD on the selectivity filter, used as reference for the alignments, is separated for clarity. Shaker’s Gly466 and aligning residues are underlined. Shaker’s 475 and aligning residues in Kv channels are individualized for clarity. Aligning with Shaker 475 are KcsA’s Ala108, KvAP’s Gly241, MthK’s Glu92 and MSlo1’s Pro320. Aspartates and glutamates are in bold (table modified from Moscoso et al. [2012] with permission from Elsevier).